SCOPe 2.08: Domain d5yslb1: 5ysl B:10-117

Lineage for d5yslb1 (5ysl B:10-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5yslb1: 5ysl B:10-117 [349077]
   Other proteins in same PDB: d5ysla_, d5yslb2, d5yslc_, d5ysld2, d5ysle_, d5yslf2, d5yslg_, d5yslh2
   automated match to d1gm3l1

Details for d5yslb1

PDB Entry: 5ysl, 2.5 Å

PDB Description: crystal structure of antibody 1h1 fab

PDB Compounds: (B:) 1H1 light chain

SCOPe Domain Sequences for d5yslb1:

Sequence; same for both SEQRES and ATOM records:

>d5yslb1 b.1.1.0 (B:10-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diiltqspaimsaslgervtltctasssvsssylhwyqqkpgsspklwiystynlagavp
prfsgsgsgtsysltissmeaedaatyycqqyhrspwtfgggtkleik

Timeline for d5yslb1:

• d5yslb1 first appeared in SCOPe 2.07