Lineage for d1dls__ (1dls -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) 
Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [53607] (11 PDB entries) 
Domain d1dls__: 1dls - [34906]
Details for d1dls__
PDB Entry: 1dls (more details), 2.3 Å
PDB Description: methotrexate-resistant variants of human dihydrofolate reductase with substitution of leucine 22: kinetics, crystallography and potential as selectable markers
SCOP Domain Sequences for d1dls__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dls__ c.71.1.1 (-) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens)}
vgslncivavsqnmgigkngdypwpplrnefryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd
SCOP Domain Coordinates for d1dls__:
Click to download the PDB-style file with coordinates for d1dls__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dls__:
- d1dls__ first appeared (with stable ids) in SCOP 1.55
- d1dls__ appears in SCOP 1.59
- d1dls__ appears in the current release, SCOPe 2.08, called d1dlsa_
View in 3D