Lineage for d1hfpa_ (1hfp A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153920Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2153968Species Human (Homo sapiens) [TaxId:9606] [53607] (73 PDB entries)
  8. 2154041Domain d1hfpa_: 1hfp A: [34904]
    complexed with mot, ndp

Details for d1hfpa_

PDB Entry: 1hfp (more details), 2.1 Å

PDB Description: comparison of ternary crystal complexes of human dihydrofolate reductase with nadph and a classical antitumor furopyrimdine
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1hfpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfpa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdlpwpplrnegryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOPe Domain Coordinates for d1hfpa_:

Click to download the PDB-style file with coordinates for d1hfpa_.
(The format of our PDB-style files is described here.)

Timeline for d1hfpa_: