Lineage for d1hfp__ (1hfp -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) 
Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [53607] (11 PDB entries) 
Domain d1hfp__: 1hfp - [34904]
Details for d1hfp__
PDB Entry: 1hfp (more details), 2.1 Å
PDB Description: comparison of ternary crystal complexes of human dihydrofolate reductase with nadph and a classical antitumor furopyrimdine
SCOP Domain Sequences for d1hfp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfp__ c.71.1.1 (-) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens)}
vgslncivavsqnmgigkngdlpwpplrnegryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd
SCOP Domain Coordinates for d1hfp__:
Click to download the PDB-style file with coordinates for d1hfp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hfp__:
- d1hfp__ first appeared (with stable ids) in SCOP 1.55
- d1hfp__ appears in SCOP 1.57
- d1hfp__ appears in SCOP 1.61
- d1hfp__ appears in the current release, SCOPe 2.08, called d1hfpa_
View in 3D