SCOPe 2.08: Domain d5x0td2: 5x0t D:129-233

Lineage for d5x0td2 (5x0t D:129-233)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5x0td2: 5x0t D:129-233 [349030]
   Other proteins in same PDB: d5x0ta_, d5x0tb1, d5x0tc_, d5x0td1
   automated match to d1igcl2

Details for d5x0td2

PDB Entry: 5x0t, 2.5 Å

PDB Description: crystal structure of cd147 c2 domain in complex with fab of its monoclonal antibody 6h8

PDB Compounds: (D:) 6H8 Fab fragment light chain

SCOPe Domain Sequences for d5x0td2:

Sequence; same for both SEQRES and ATOM records:

>d5x0td2 b.1.1.0 (D:129-233) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5x0td2:

• d5x0td2 first appeared in SCOPe 2.07