Lineage for d1hfq__ (1hfq -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) 
Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [53607] (11 PDB entries) 
Domain d1hfq__: 1hfq - [34903]
Details for d1hfq__
PDB Entry: 1hfq (more details), 2.1 Å
PDB Description: comparison of ternary crystal complexes of human dihydrofolate reductase with nadph and a classical antitumor furopyrimdine
SCOP Domain Sequences for d1hfq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfq__ c.71.1.1 (-) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens)}
vgslncivavsqnmgigkngdlpwpplrnesryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd
SCOP Domain Coordinates for d1hfq__:
Click to download the PDB-style file with coordinates for d1hfq__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hfq__:
- d1hfq__ appears in SCOP 1.57
- d1hfq__ appears in the current release, SCOPe 2.08, called d1hfqa_
View in 3D