SCOPe 2.08: Domain d5yw5a1: 5yw5 A:1-175

Lineage for d5yw5a1 (5yw5 A:1-175)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Francisella tularensis [TaxId:263] [348987] (3 PDB entries)

8. Domain d5yw5a1: 5yw5 A:1-175 [349016]
   Other proteins in same PDB: d5yw5a2, d5yw5b2
   automated match to d2dy0b_
   complexed with ade

Details for d5yw5a1

PDB Entry: 5yw5, 1.9 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase from francisella tularensis in complex with adenine

PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d5yw5a1:

Sequence; same for both SEQRES and ATOM records:

>d5yw5a1 c.61.1.0 (A:1-175) automated matches {Francisella tularensis [TaxId: 263]}
mnldfikskiaavpdfpkpgimfrditplladpqglrktaeamaqelknkgiqptivagt
esrgfifgvalaevlglgfvpvrkpgklpratysvkydleygsdsleihqdafkvtdevl
vvddllatggtakatvdliektqakvaglifvmeldglggrevlagynvsalikf

Timeline for d5yw5a1:

• d5yw5a1 first appeared in SCOPe 2.07