| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
| Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species) |
| Species Mycobacterium neoaurum [TaxId:1795] [419784] (1 PDB entry) |
| Domain d5z3rg_: 5z3r G: [349009] automated match to d2z7ac_ |
PDB Entry: 5z3r (more details), 2.42 Å
SCOPe Domain Sequences for d5z3rg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z3rg_ d.17.4.3 (G:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Mycobacterium neoaurum [TaxId: 1795]}
spvvaasqnswrcvqsgdregwlalmaddivvedpigeavtnpdgtgvrgkaalaafydt
nigpnrlrvtceatfpssspteiayilvlettfpngfvatvrgvftyrvddaglitnlrg
ywnmdamtfte
Timeline for d5z3rg_: