Lineage for d1dr4a_ (1dr4 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511228Species Chicken (Gallus gallus) [TaxId:9031] [53606] (8 PDB entries)
  8. 2511236Domain d1dr4a_: 1dr4 A: [34900]
    complexed with ca, hbi, hg, nap

Details for d1dr4a_

PDB Entry: 1dr4 (more details), 2.4 Å

PDB Description: crystal structures of organomercurial-activated chicken liver dihydrofolate reductase complexes
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1dr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr4a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Chicken (Gallus gallus) [TaxId: 9031]}
vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
vyqksv

SCOPe Domain Coordinates for d1dr4a_:

Click to download the PDB-style file with coordinates for d1dr4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dr4a_: