Lineage for d5yw2a1 (5yw2 A:1-175)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891967Species Francisella tularensis [TaxId:263] [348987] (3 PDB entries)
  8. 2891976Domain d5yw2a1: 5yw2 A:1-175 [348995]
    Other proteins in same PDB: d5yw2a2, d5yw2b2, d5yw2c2, d5yw2d2
    automated match to d2dy0b_
    complexed with cl, mg, so4

Details for d5yw2a1

PDB Entry: 5yw2 (more details), 2.28 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase from francisella tularensis.
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d5yw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yw2a1 c.61.1.0 (A:1-175) automated matches {Francisella tularensis [TaxId: 263]}
mnldfikskiaavpdfpkpgimfrditplladpqglrktaeamaqelknkgiqptivagt
esrgfifgvalaevlglgfvpvrkpgklpratysvkydleygsdsleihqdafkvtdevl
vvddllatggtakatvdliektqakvaglifvmeldglggrevlagynvsalikf

SCOPe Domain Coordinates for d5yw2a1:

Click to download the PDB-style file with coordinates for d5yw2a1.
(The format of our PDB-style files is described here.)

Timeline for d5yw2a1: