Lineage for d5yjma_ (5yjm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795068Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2795069Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)
  8. 2795077Domain d5yjma_: 5yjm A: [348986]
    automated match to d1klta_
    complexed with 8w3, nag, zn

Details for d5yjma_

PDB Entry: 5yjm (more details), 1.9 Å

PDB Description: human chymase in complex with 7-oxo-3-(phenoxyimino)-1,4-diazepane derivative
PDB Compounds: (A:) human chymase

SCOPe Domain Sequences for d5yjma_:

Sequence, based on SEQRES records: (download)

>d5yjma_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteskphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagvaqgivsygrsdakppavftrishyrpwinqilqan

Sequence, based on observed residues (ATOM records): (download)

>d5yjma_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteskphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpgrmcrvagw
grtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpllc
agvaqgivsygrsdakppavftrishyrpwinqilqan

SCOPe Domain Coordinates for d5yjma_:

Click to download the PDB-style file with coordinates for d5yjma_.
(The format of our PDB-style files is described here.)

Timeline for d5yjma_: