Lineage for d1dr3__ (1dr3 -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) 
Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [53606] (8 PDB entries) 
Domain d1dr3__: 1dr3 - [34897]
Details for d1dr3__
PDB Entry: 1dr3 (more details), 2.3 Å
PDB Description: 2.3 angstroms crystal structure of chicken liver dihydrofolate reductase complexed with thionadp+ and biopterin
SCOP Domain Sequences for d1dr3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dr3__ c.71.1.1 (-) Dihydrofolate reductases, eukaryotic type {Chicken (Gallus gallus)}
vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
vyqksv
SCOP Domain Coordinates for d1dr3__:
Click to download the PDB-style file with coordinates for d1dr3__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dr3__:
- d1dr3__ first appeared (with stable ids) in SCOP 1.55
- d1dr3__ appears in SCOP 1.59
- d1dr3__ appears in the current release, SCOPe 2.08, called d1dr3a_
View in 3D