Lineage for d8dfra_ (8dfr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2137011Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2137024Species Chicken (Gallus gallus) [TaxId:9031] [53606] (8 PDB entries)
  8. 2137025Domain d8dfra_: 8dfr A: [34895]
    complexed with ca, ndp

Details for d8dfra_

PDB Entry: 8dfr (more details), 1.7 Å

PDB Description: refined crystal structures of chicken liver dihydrofolate reductase. 3 angstroms apo-enzyme and 1.7 angstroms nadph holo-enzyme complex
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d8dfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8dfra_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Chicken (Gallus gallus) [TaxId: 9031]}
vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
vyqksv

SCOPe Domain Coordinates for d8dfra_:

Click to download the PDB-style file with coordinates for d8dfra_.
(The format of our PDB-style files is described here.)

Timeline for d8dfra_: