![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5yc5a2: 5yc5 A:340-444 [348944] Other proteins in same PDB: d5yc5c1, d5yc5c2 automated match to d1hzhh4 complexed with cl |
PDB Entry: 5yc5 (more details), 2.71 Å
SCOPe Domain Sequences for d5yc5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yc5a2 b.1.1.2 (A:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]} kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
Timeline for d5yc5a2:
![]() Domains from other chains: (mouse over for more information) d5yc5b1, d5yc5b2, d5yc5c1, d5yc5c2 |