Lineage for d5xwca1 (5xwc A:2-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890638Species Aspergillus niger [TaxId:5061] [348600] (5 PDB entries)
  8. 2890639Domain d5xwca1: 5xwc A:2-187 [348940]
    automated match to d1bvua2
    complexed with 2it, 8gl, gol, nap, peg

Details for d5xwca1

PDB Entry: 5xwc (more details), 1.75 Å

PDB Description: crystal structure of aspergillus niger glutamate dehydrogenase complexed with alpha-iminoglutarate, 2-amino-2-hydroxyglutarate and nadp
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d5xwca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xwca1 c.58.1.0 (A:2-187) automated matches {Aspergillus niger [TaxId: 5061]}
snlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvq
vnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdp
kgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvlt
gkggsw

SCOPe Domain Coordinates for d5xwca1:

Click to download the PDB-style file with coordinates for d5xwca1.
(The format of our PDB-style files is described here.)

Timeline for d5xwca1: