SCOPe 2.08: Domain d5yx4a1: 5yx4 A:1-231

Lineage for d5yx4a1 (5yx4 A:1-231)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.36: Chalcone isomerase [54625] (1 superfamily)
   beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567

4. Superfamily d.36.1: Chalcone isomerase [54626] (2 families)
   automatically mapped to Pfam PF02431

5. Family d.36.1.0: automated matches [254325] (1 protein)
   not a true family

6. Protein automated matches [254745] (3 species)
   not a true protein

7. Species Deschampsia antarctica [TaxId:159298] [348925] (2 PDB entries)

8. Domain d5yx4a1: 5yx4 A:1-231 [348934]
   Other proteins in same PDB: d5yx4a2
   automated match to d1jx0a_
   complexed with hcc

Details for d5yx4a1

PDB Entry: 5yx4, 2.1 Å

PDB Description: isoliquiritigenin-complexed chalcone isomerase (s189a) from the antarctic vascular plant deschampsia antarctica (dachi1)

PDB Compounds: (A:) Chalcone-flavonone isomerase family protein

SCOPe Domain Sequences for d5yx4a1:

Sequence; same for both SEQRES and ATOM records:

>d5yx4a1 d.36.1.0 (A:1-231) automated matches {Deschampsia antarctica [TaxId: 159298]}
mavselevdgvvfpslarppgsahshflagagvrgmeiggnfikftaigvylqadaavsa
lakkwagkaadelasdaaffrdvvtgefekftqvtmilpltgaqysekvtencvaywkav
gaytdaeaaavdkfkeafktetfppgasilfthspagvltvafsknssvpesggaaienr
plceavleaiigehgvspaaklslatrvaellkeaasvdepaaaepvsvsa

Timeline for d5yx4a1:

• d5yx4a1 first appeared in SCOPe 2.07