Lineage for d5yx4a1 (5yx4 A:1-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943206Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2943207Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2943235Family d.36.1.0: automated matches [254325] (1 protein)
    not a true family
  6. 2943236Protein automated matches [254745] (3 species)
    not a true protein
  7. 2943237Species Deschampsia antarctica [TaxId:159298] [348925] (2 PDB entries)
  8. 2943238Domain d5yx4a1: 5yx4 A:1-231 [348934]
    Other proteins in same PDB: d5yx4a2
    automated match to d1jx0a_
    complexed with hcc

Details for d5yx4a1

PDB Entry: 5yx4 (more details), 2.1 Å

PDB Description: isoliquiritigenin-complexed chalcone isomerase (s189a) from the antarctic vascular plant deschampsia antarctica (dachi1)
PDB Compounds: (A:) Chalcone-flavonone isomerase family protein

SCOPe Domain Sequences for d5yx4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yx4a1 d.36.1.0 (A:1-231) automated matches {Deschampsia antarctica [TaxId: 159298]}
mavselevdgvvfpslarppgsahshflagagvrgmeiggnfikftaigvylqadaavsa
lakkwagkaadelasdaaffrdvvtgefekftqvtmilpltgaqysekvtencvaywkav
gaytdaeaaavdkfkeafktetfppgasilfthspagvltvafsknssvpesggaaienr
plceavleaiigehgvspaaklslatrvaellkeaasvdepaaaepvsvsa

SCOPe Domain Coordinates for d5yx4a1:

Click to download the PDB-style file with coordinates for d5yx4a1.
(The format of our PDB-style files is described here.)

Timeline for d5yx4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yx4a2