Lineage for d5yofb_ (5yof B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. Protein automated matches [190658] (12 species)
    not a true protein
  7. Species Zika virus [TaxId:64320] [327129] (7 PDB entries)
  8. Domain d5yofb_: 5yof B: [348928]
    Other proteins in same PDB: d5yofa_
    automated match to d3e90b_
    complexed with 7hs

Details for d5yofb_

PDB Entry: 5yof (more details), 1.51 Å

PDB Description: crystal structure of zika virus ns3 protease in complex with a dipeptide inhibitor
PDB Compounds: (B:) NS3 protease

SCOPe Domain Sequences for d5yofb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yofb_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]}
gettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqd
lvsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagts
gspildksgrviglygngvvikngsyvsaitqgkre

SCOPe Domain Coordinates for d5yofb_ are not available.

Timeline for d5yofb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5yofa_