SCOPe 2.08: Domain d5yode_: 5yod E:

Lineage for d5yode_ (5yod E:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327137] (14 PDB entries)

8. Domain d5yode_: 5yod E: [348927]
   Other proteins in same PDB: d5yodb_, d5yodd_, d5yodf_, d5yodh_
   automated match to d2ggva_
   complexed with bez

Details for d5yode_

PDB Entry: 5yod, 1.9 Å

PDB Description: crystal structure of zika virus ns3 protease in complex with a small molecule inhibitor

PDB Compounds: (E:) NS2B cofactor

SCOPe Domain Sequences for d5yode_:

Sequence; same for both SEQRES and ATOM records:

>d5yode_ g.96.1.0 (E:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

Timeline for d5yode_:

• d5yode_ first appeared in SCOPe 2.07