Lineage for d5yodf_ (5yod F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406625Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2406715Protein automated matches [190658] (12 species)
    not a true protein
  7. 2406844Species Zika virus [TaxId:64320] [327129] (7 PDB entries)
  8. 2406857Domain d5yodf_: 5yod F: [348924]
    Other proteins in same PDB: d5yoda_, d5yodc_, d5yode_, d5yodg_
    automated match to d3e90b_
    complexed with bez

Details for d5yodf_

PDB Entry: 5yod (more details), 1.9 Å

PDB Description: crystal structure of zika virus ns3 protease in complex with a small molecule inhibitor
PDB Compounds: (F:) NS3 protease

SCOPe Domain Sequences for d5yodf_:

Sequence, based on SEQRES records: (download)

>d5yodf_ b.47.1.3 (F:) automated matches {Zika virus [TaxId: 64320]}
ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
spildksgrviglygngvvikngsyvsaitqgkr

Sequence, based on observed residues (ATOM records): (download)

>d5yodf_ b.47.1.3 (F:) automated matches {Zika virus [TaxId: 64320]}
ettdgvyrvmtrlgstqvgvgvmqegvfhtmwhvtkgaalrsgrldpywgdvkqdlvsyc
gpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgspil
dksgrviglygngvvikngsyvsaitqgkr

SCOPe Domain Coordinates for d5yodf_:

Click to download the PDB-style file with coordinates for d5yodf_.
(The format of our PDB-style files is described here.)

Timeline for d5yodf_: