![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein automated matches [190658] (12 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [327129] (7 PDB entries) |
![]() | Domain d5yodf_: 5yod F: [348924] Other proteins in same PDB: d5yoda_, d5yodc_, d5yode_, d5yodg_ automated match to d3e90b_ complexed with bez |
PDB Entry: 5yod (more details), 1.9 Å
SCOPe Domain Sequences for d5yodf_:
Sequence, based on SEQRES records: (download)
>d5yodf_ b.47.1.3 (F:) automated matches {Zika virus [TaxId: 64320]} ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg spildksgrviglygngvvikngsyvsaitqgkr
>d5yodf_ b.47.1.3 (F:) automated matches {Zika virus [TaxId: 64320]} ettdgvyrvmtrlgstqvgvgvmqegvfhtmwhvtkgaalrsgrldpywgdvkqdlvsyc gpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgspil dksgrviglygngvvikngsyvsaitqgkr
Timeline for d5yodf_: