![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) |
![]() | Protein Dihydrofolate reductase, prokaryotic type [53599] (6 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [53603] (2 PDB entries) |
![]() | Domain d1cz3a_: 1cz3 A: [34891] |
PDB Entry: 1cz3 (more details), 2.1 Å
SCOP Domain Sequences for d1cz3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cz3a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve
Timeline for d1cz3a_: