Lineage for d1cz3a_ (1cz3 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126773Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 126774Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 126775Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 126779Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 126855Species Thermotoga maritima [TaxId:243274] [53603] (2 PDB entries)
  8. 126858Domain d1cz3a_: 1cz3 A: [34891]

Details for d1cz3a_

PDB Entry: 1cz3 (more details), 2.1 Å

PDB Description: dihydrofolate reductase from thermotoga maritima

SCOP Domain Sequences for d1cz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz3a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima}
akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve

SCOP Domain Coordinates for d1cz3a_:

Click to download the PDB-style file with coordinates for d1cz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1cz3a_: