Lineage for d5oy06_ (5oy0 6:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631476Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2631477Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 2631481Protein automated matches [236583] (4 species)
    not a true protein
  7. 2631484Species Synechocystis sp. [TaxId:1111708] [347847] (2 PDB entries)
  8. 2631485Domain d5oy06_: 5oy0 6: [348901]
    Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy05_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0e_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_
    automated match to d4kt0f_
    complexed with 45d, act, bcr, c7z, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd

Details for d5oy06_

PDB Entry: 5oy0 (more details), 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution
PDB Compounds: (6:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d5oy06_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oy06_ f.23.16.1 (6:) automated matches {Synechocystis sp. [TaxId: 1111708]}
addfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrft
hagdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwpl
aavgeytsgklvmkdseiptspr

SCOPe Domain Coordinates for d5oy06_:

Click to download the PDB-style file with coordinates for d5oy06_.
(The format of our PDB-style files is described here.)

Timeline for d5oy06_: