SCOPe 2.08: Domain d5yodd_: 5yod D:

Lineage for d5yodd_ (5yod D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327129] (7 PDB entries)

8. Domain d5yodd_: 5yod D: [348898]
   Other proteins in same PDB: d5yoda_, d5yodc_, d5yode_, d5yodg_
   automated match to d3e90b_
   complexed with bez

Details for d5yodd_

PDB Entry: 5yod, 1.9 Å

PDB Description: crystal structure of zika virus ns3 protease in complex with a small molecule inhibitor

PDB Compounds: (D:) NS3 protease

SCOPe Domain Sequences for d5yodd_:

Sequence, based on SEQRES records:

>d5yodd_ b.47.1.3 (D:) automated matches {Zika virus [TaxId: 64320]}
ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
spildksgrviglygngvvikngsyvsaitqgkr

Sequence, based on observed residues (ATOM records):

>d5yodd_ b.47.1.3 (D:) automated matches {Zika virus [TaxId: 64320]}
ettdgvyrvmtrlgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvs
ycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgsp
ildksgrviglygngvvikngsyvsaitqgkr

Timeline for d5yodd_:

• d5yodd_ first appeared in SCOPe 2.07