Lineage for d5yo5g_ (5yo5 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699501Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2699502Protein Cytochrome b562 [47177] (1 species)
  7. 2699503Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)
  8. 2699691Domain d5yo5g_: 5yo5 G: [348894]
    Other proteins in same PDB: d5yo5a2, d5yo5c2
    automated match to d1m6ta_

Details for d5yo5g_

PDB Entry: 5yo5 (more details), 2.2 Å

PDB Description: crystal structure of b562ril with engineered disulfide bond a20c-q25c
PDB Compounds: (G:) Soluble cytochrome b562

SCOPe Domain Sequences for d5yo5g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yo5g_ a.24.3.1 (G:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
dlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemkdf
rhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl

SCOPe Domain Coordinates for d5yo5g_:

Click to download the PDB-style file with coordinates for d5yo5g_.
(The format of our PDB-style files is described here.)

Timeline for d5yo5g_: