Lineage for d1d1ga_ (1d1g A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74023Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 74024Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 74025Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 74029Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 74105Species Thermotoga maritima [TaxId:243274] [53603] (2 PDB entries)
  8. 74106Domain d1d1ga_: 1d1g A: [34889]

Details for d1d1ga_

PDB Entry: 1d1g (more details), 2.1 Å

PDB Description: dihydrofolate reductase from thermotoga maritima

SCOP Domain Sequences for d1d1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima}
akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysve

SCOP Domain Coordinates for d1d1ga_:

Click to download the PDB-style file with coordinates for d1d1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ga_: