Lineage for d5ypkc_ (5ypk C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603559Species Escherichia coli [TaxId:562] [226145] (21 PDB entries)
  8. 2603584Domain d5ypkc_: 5ypk C: [348884]
    automated match to d4eyba_
    complexed with cl, hiw, na, so4, zn

Details for d5ypkc_

PDB Entry: 5ypk (more details), 2 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed imipenem representing an ei2 complex
PDB Compounds: (C:) Metallo-beta-lactamase NDM-1

SCOPe Domain Sequences for d5ypkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ypkc_ d.157.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5ypkc_:

Click to download the PDB-style file with coordinates for d5ypkc_.
(The format of our PDB-style files is described here.)

Timeline for d5ypkc_: