Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (12 species) not a true protein |
Species Zika virus [TaxId:64320] [327129] (7 PDB entries) |
Domain d5yodh_: 5yod H: [348876] Other proteins in same PDB: d5yoda_, d5yodc_, d5yode_, d5yodg_ automated match to d3e90b_ complexed with bez |
PDB Entry: 5yod (more details), 1.9 Å
SCOPe Domain Sequences for d5yodh_:
Sequence, based on SEQRES records: (download)
>d5yodh_ b.47.1.3 (H:) automated matches {Zika virus [TaxId: 64320]} ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg spildksgrviglygngvvikngsyvsaitqgkr
>d5yodh_ b.47.1.3 (H:) automated matches {Zika virus [TaxId: 64320]} ettdgvyrvmtrtqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvsycg pwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgspild ksgrviglygngvvikngsyvsaitqgkr
Timeline for d5yodh_: