Lineage for d5yi5g_ (5yi5 G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317349Species Human (Homo sapiens) [TaxId:9606] [255624] (13 PDB entries)
  8. 2317478Domain d5yi5g_: 5yi5 G: [348873]
    automated match to d5n27a_
    mutant

Details for d5yi5g_

PDB Entry: 5yi5 (more details), 3 Å

PDB Description: human ferritin mutant - e-helix deletion
PDB Compounds: (G:) ferritin heavy chain

SCOPe Domain Sequences for d5yi5g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yi5g_ a.25.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d5yi5g_:

Click to download the PDB-style file with coordinates for d5yi5g_.
(The format of our PDB-style files is described here.)

Timeline for d5yi5g_: