![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
![]() | Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) ![]() Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
![]() | Family g.96.1.0: automated matches [324385] (1 protein) not a true family |
![]() | Protein automated matches [324386] (3 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [327137] (14 PDB entries) |
![]() | Domain d5yodg_: 5yod G: [348870] Other proteins in same PDB: d5yodb_, d5yodd_, d5yodf_, d5yodh_ automated match to d2ggva_ complexed with bez |
PDB Entry: 5yod (more details), 1.9 Å
SCOPe Domain Sequences for d5yodg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yodg_ g.96.1.0 (G:) automated matches {Zika virus [TaxId: 64320]} dmyieragditwekdaevtgnsprldvaldesgdfslv
Timeline for d5yodg_: