SCOPe 2.08: Domain d5yecb_: 5yec B:

Lineage for d5yecb_ (5yec B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries)

8. Domain d5yecb_: 5yec B: [348862]
   automated match to d5azha_
   complexed with atp, mg, zn

Details for d5yecb_

PDB Entry: 5yec, 2.15 Å

PDB Description: crystal structure of atg7ctd-atg8-mgatp complex in form ii

PDB Compounds: (B:) Autophagy-related protein 8

SCOPe Domain Sequences for d5yecb_:

Sequence, based on SEQRES records:

>d5yecb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv
irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysg

Sequence, based on observed residues (ATOM records):

>d5yecb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv
irkrimlppaififvndtlpptaalmsaiyqehkdkdgflyvtysg

Timeline for d5yecb_:

• d5yecb_ first appeared in SCOPe 2.07