Lineage for d5yoda_ (5yod A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643668Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2643669Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2643682Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 2643683Protein automated matches [324386] (3 species)
    not a true protein
  7. 2643694Species Zika virus [TaxId:64320] [327137] (14 PDB entries)
  8. 2643707Domain d5yoda_: 5yod A: [348860]
    Other proteins in same PDB: d5yodb_, d5yodd_, d5yodf_, d5yodh_
    automated match to d2ggva_
    complexed with bez

Details for d5yoda_

PDB Entry: 5yod (more details), 1.9 Å

PDB Description: crystal structure of zika virus ns3 protease in complex with a small molecule inhibitor
PDB Compounds: (A:) NS2B cofactor

SCOPe Domain Sequences for d5yoda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yoda_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

SCOPe Domain Coordinates for d5yoda_:

Click to download the PDB-style file with coordinates for d5yoda_.
(The format of our PDB-style files is described here.)

Timeline for d5yoda_: