Lineage for d5ygha_ (5ygh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736227Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 2736228Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) (S)
    automatically mapped to Pfam PF01003
  5. 2736252Family a.190.1.0: automated matches [348805] (1 protein)
    not a true family
  6. 2736253Protein automated matches [348806] (3 species)
    not a true protein
  7. 2736257Species Zika virus (strain mr 766) [TaxId:64320] [348807] (1 PDB entry)
  8. 2736258Domain d5ygha_: 5ygh A: [348857]
    automated match to d1r6ra_

Details for d5ygha_

PDB Entry: 5ygh (more details), 1.88 Å

PDB Description: crystal structure of the capsid protein from zika virus
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d5ygha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ygha_ a.190.1.0 (A:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
pfgglkrlpaglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiikkfk
kdlaamlriinar

SCOPe Domain Coordinates for d5ygha_:

Click to download the PDB-style file with coordinates for d5ygha_.
(The format of our PDB-style files is described here.)

Timeline for d5ygha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5yghb_