SCOPe 2.06: Domain d1df7a_: 1df7 A:

Lineage for d1df7a_ (1df7 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [53602] (6 PDB entries)

8. Domain d1df7a_: 1df7 A: [34885]
   complexed with gol, mtx, ndp, so4

Details for d1df7a_

PDB Entry: 1df7, 1.7 Å

PDB Description: dihydrofolate reductase of mycobacterium tuberculosis complexed with nadph and methotrexate

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1df7a_:

Sequence; same for both SEQRES and ATOM records:

>d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d1df7a_:

• d1df7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1df7a_ appears in SCOPe 2.05
  
• d1df7a_ appears in SCOPe 2.07
  
• d1df7a_ appears in the current release, SCOPe 2.08