Lineage for d5ycxa1 (5ycx A:1-256)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450398Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2450404Species Bacillus cereus [TaxId:226900] [192761] (6 PDB entries)
  8. 2450405Domain d5ycxa1: 5ycx A:1-256 [348849]
    Other proteins in same PDB: d5ycxa2
    automated match to d2qioa_

Details for d5ycxa1

PDB Entry: 5ycx (more details), 1.7 Å

PDB Description: x-ray structure of enoyl-acyl carrier protein reductase from bacillus anthracis with c-terminal his tag (apo form)
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI

SCOPe Domain Sequences for d5ycxa1:

Sequence, based on SEQRES records: (download)

>d5ycxa1 c.2.1.2 (A:1-256) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni
safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq
hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg
vtgenihvdsgyhilg

Sequence, based on observed residues (ATOM records): (download)

>d5ycxa1 c.2.1.2 (A:1-256) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafandgfllaqnisafsltavareak
kvmteggniltltylggvakasleasvkylandlgqhgirvnaisagpirtlfnsilrei
eeraplrrtttqeevgdtavflfsdlargvtgenihvdsgyhilg

SCOPe Domain Coordinates for d5ycxa1:

Click to download the PDB-style file with coordinates for d5ycxa1.
(The format of our PDB-style files is described here.)

Timeline for d5ycxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ycxa2