Lineage for d5xuia1 (5xui A:449-769)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342579Species Human (Homo sapiens) [TaxId:9606] [188676] (127 PDB entries)
  8. 3048774Domain d5xuia1: 5xui A:449-769 [348836]
    Other proteins in same PDB: d5xuia2, d5xuib2
    automated match to d4ajmd_
    complexed with 8g3, mg, zn

Details for d5xuia1

PDB Entry: 5xui (more details), 2.77 Å

PDB Description: crystal structure of pde10a in complex with 2-methyl-5-[2-([1,2, 4]triazolo[1,5-a]pyrimidin-2-yl)et hyl]pyrazolo[1,5-a]pyrimidin-7-ol
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5xuia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xuia1 a.211.1.0 (A:449-769) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

SCOPe Domain Coordinates for d5xuia1:

Click to download the PDB-style file with coordinates for d5xuia1.
(The format of our PDB-style files is described here.)

Timeline for d5xuia1:

  • d5xuia1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07

View in 3D
Domains from same chain:
(mouse over for more information)
d5xuia2