SCOPe 2.08: Domain d5yh8a1: 5yh8 A:1-507

Lineage for d5yh8a1 (5yh8 A:1-507)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [348799] (4 PDB entries)

8. Domain d5yh8a1: 5yh8 A:1-507 [348830]
   Other proteins in same PDB: d5yh8a2
   automated match to d4oera_
   complexed with 8ux, gol, ni, peg

Details for d5yh8a1

PDB Entry: 5yh8, 2.12 Å

PDB Description: the crystal structure of staphylococcus aureus cnta in complex with staphylopine and nickel

PDB Compounds: (A:) Nickel ABC transporter substrate-binding protein

SCOPe Domain Sequences for d5yh8a1:

Sequence; same for both SEQRES and ATOM records:

>d5yh8a1 c.94.1.0 (A:1-507) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleekkenkqltyttvkdigdmnphvyggsmsaesmiyeplvrntkdgikpllakkwdvs
edgktytfhlrddvkfhdgtpfdadavkknidavqenkklhswlkistlidnvkvkdkyt
velnlkeayqpalaelamprpyvfvspkdfkngttkdgvkkfdgtgpfklgehkkdesad
fnkndqywgeksklnkvqakvmpagetaflsmkkgetnfaftddrgtdsldkdslkqlkd
tgdyqvkrsqpmntkmlvvnsgkkdnavsdktvrqaighmvnrdkiakeildgqekpatq
lfaknvtdinfdmptrkydlkkaeslldeagwkkgkdsdvrqkdgknlemamyydkgsss
qkeqaeylqaefkkmgiklningetsdkiaerrtsgdydlmfnqtwgllydpqstiaafk
akngyesatsgienkdkiynsiddafkiqngkersdayknilkqiddegifipishgsmt
vvapkdlekvsftqsqyelpfnemqyk

Timeline for d5yh8a1:

• d5yh8a1 first appeared in SCOPe 2.07