Lineage for d5yh8a1 (5yh8 A:1-507)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:1280] [348799] (4 PDB entries)
  8. Domain d5yh8a1: 5yh8 A:1-507 [348830]
    Other proteins in same PDB: d5yh8a2
    automated match to d4oera_
    complexed with 8ux, gol, ni, peg

Details for d5yh8a1

PDB Entry: 5yh8 (more details), 2.12 Å

PDB Description: the crystal structure of staphylococcus aureus cnta in complex with staphylopine and nickel
PDB Compounds: (A:) Nickel ABC transporter substrate-binding protein

SCOPe Domain Sequences for d5yh8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yh8a1 c.94.1.0 (A:1-507) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleekkenkqltyttvkdigdmnphvyggsmsaesmiyeplvrntkdgikpllakkwdvs
edgktytfhlrddvkfhdgtpfdadavkknidavqenkklhswlkistlidnvkvkdkyt
velnlkeayqpalaelamprpyvfvspkdfkngttkdgvkkfdgtgpfklgehkkdesad
fnkndqywgeksklnkvqakvmpagetaflsmkkgetnfaftddrgtdsldkdslkqlkd
tgdyqvkrsqpmntkmlvvnsgkkdnavsdktvrqaighmvnrdkiakeildgqekpatq
lfaknvtdinfdmptrkydlkkaeslldeagwkkgkdsdvrqkdgknlemamyydkgsss
qkeqaeylqaefkkmgiklningetsdkiaerrtsgdydlmfnqtwgllydpqstiaafk
akngyesatsgienkdkiynsiddafkiqngkersdayknilkqiddegifipishgsmt
vvapkdlekvsftqsqyelpfnemqyk

SCOPe Domain Coordinates for d5yh8a1 are not available.

Timeline for d5yh8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yh8a2