SCOP 1.63: Domain d1ao8__: 1ao8 -

Lineage for d1ao8__ (1ao8 -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Lactobacillus casei [TaxId:1582] [53601] (6 PDB entries)

8. Domain d1ao8__: 1ao8 - [34883]
   complexed with mtx

Details for d1ao8__

PDB Entry: 1ao8

PDB Description: dihydrofolate reductase complexed with methotrexate, nmr, 21 structures

SCOP Domain Sequences for d1ao8__:

Sequence; same for both SEQRES and ATOM records:

>d1ao8__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

Timeline for d1ao8__:

• d1ao8__ first appeared (with stable ids) in SCOP 1.55
  
• d1ao8__ appears in SCOP 1.61
  
• d1ao8__ appears in SCOP 1.65
  
• d1ao8__ appears in the current release, SCOPe 2.08, called d1ao8a_