Lineage for d1ao8__ (1ao8 -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184741Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 184742Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 184743Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 184747Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 184812Species Lactobacillus casei [TaxId:1582] [53601] (5 PDB entries)
  8. 184816Domain d1ao8__: 1ao8 - [34883]

Details for d1ao8__

PDB Entry: 1ao8 (more details)

PDB Description: dihydrofolate reductase complexed with methotrexate, nmr, 21 structures

SCOP Domain Sequences for d1ao8__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao8__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

SCOP Domain Coordinates for d1ao8__:

Click to download the PDB-style file with coordinates for d1ao8__.
(The format of our PDB-style files is described here.)

Timeline for d1ao8__: