Lineage for d5xoda1 (5xod A:262-456)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372850Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2372883Protein automated matches [323874] (1 species)
    not a true protein
  7. 2372884Species Human (Homo sapiens) [TaxId:9606] [323875] (3 PDB entries)
  8. 3048766Domain d5xoda1: 5xod A:262-456 [348828]
    Other proteins in same PDB: d5xoda2
    automated match to d1mk2a_

Details for d5xoda1

PDB Entry: 5xod (more details), 1.85 Å

PDB Description: crystal structure of human smad2-ski complex
PDB Compounds: (A:) Mothers against decapentaplegic homolog 2

SCOPe Domain Sequences for d5xoda1:

Sequence, based on SEQRES records: (download)

>d5xoda1 b.26.1.1 (A:262-456) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlqpvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnr
natvemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcn
lkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielh
lngplqwldkvltqm

Sequence, based on observed residues (ATOM records): (download)

>d5xoda1 b.26.1.1 (A:262-456) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlqpvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnr
natvemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrpatvckippgcnlkif
nnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngp
lqwldkvltqm

SCOPe Domain Coordinates for d5xoda1:

Click to download the PDB-style file with coordinates for d5xoda1.
(The format of our PDB-style files is described here.)

Timeline for d5xoda1:

  • d5xoda1 is new in SCOPe 2.07-stable