Lineage for d1diu__ (1diu -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126773Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 126774Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 126775Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 126779Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 126844Species Lactobacillus casei [TaxId:1582] [53601] (5 PDB entries)
  8. 126847Domain d1diu__: 1diu - [34882]

Details for d1diu__

PDB Entry: 1diu (more details)

PDB Description: dihydrofolate reductase (e.c.1.5.1.3) complex with brodimoprim-4,6- dicarboxylate

SCOP Domain Sequences for d1diu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diu__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

SCOP Domain Coordinates for d1diu__:

Click to download the PDB-style file with coordinates for d1diu__.
(The format of our PDB-style files is described here.)

Timeline for d1diu__: