Lineage for d5yhga_ (5yhg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916148Species Staphylococcus aureus [TaxId:1280] [348799] (4 PDB entries)
  8. 2916149Domain d5yhga_: 5yhg A: [348810]
    automated match to d4oera_
    complexed with 8ux, act, cl, gol, peg, zn

Details for d5yhga_

PDB Entry: 5yhg (more details), 2.03 Å

PDB Description: the crystal structure of staphylococcus aureus cnta in complex with staphylopine and zinc
PDB Compounds: (A:) Nickel ABC transporter substrate-binding protein

SCOPe Domain Sequences for d5yhga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yhga_ c.94.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleekkenkqltyttvkdigdmnphvyggsmsaesmiyeplvrntkdgikpllakkwdvs
edgktytfhlrddvkfhdgtpfdadavkknidavqenkklhswlkistlidnvkvkdkyt
velnlkeayqpalaelamprpyvfvspkdfkngttkdgvkkfdgtgpfklgehkkdesad
fnkndqywgeksklnkvqakvmpagetaflsmkkgetnfaftddrgtdsldkdslkqlkd
tgdyqvkrsqpmntkmlvvnsgkkdnavsdktvrqaighmvnrdkiakeildgqekpatq
lfaknvtdinfdmptrkydlkkaeslldeagwkkgkdsdvrqkdgknlemamyydkgsss
qkeqaeylqaefkkmgiklningetsdkiaerrtsgdydlmfnqtwgllydpqstiaafk
akngyesatsgienkdkiynsiddafkiqngkersdayknilkqiddegifipishgsmt
vvapkdlekvsftqsqyelpfnemqyk

SCOPe Domain Coordinates for d5yhga_:

Click to download the PDB-style file with coordinates for d5yhga_.
(The format of our PDB-style files is described here.)

Timeline for d5yhga_: