Lineage for d1disa_ (1dis A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618271Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1618272Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1618273Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1618302Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 1618414Species Lactobacillus casei [TaxId:1582] [53601] (10 PDB entries)
  8. 1618416Domain d1disa_: 1dis A: [34881]
    complexed with bdm

Details for d1disa_

PDB Entry: 1dis (more details)

PDB Description: dihydrofolate reductase (e.c.1.5.1.3) complex with brodimoprim-4,6- dicarboxylate
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1disa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1disa_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

SCOPe Domain Coordinates for d1disa_:

Click to download the PDB-style file with coordinates for d1disa_.
(The format of our PDB-style files is described here.)

Timeline for d1disa_: