Lineage for d5ybfc_ (5ybf C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2913864Species Human (Homo sapiens) [TaxId:9606] [189807] (8 PDB entries)
  8. 2913873Domain d5ybfc_: 5ybf C: [348809]
    automated match to d2xhda_
    complexed with 8sr, act, glu, zn

Details for d5ybfc_

PDB Entry: 5ybf (more details), 1.5 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and hbt1
PDB Compounds: (C:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5ybfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ybfc_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d5ybfc_:

Click to download the PDB-style file with coordinates for d5ybfc_.
(The format of our PDB-style files is described here.)

Timeline for d5ybfc_: