![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily) core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices |
![]() | Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) ![]() automatically mapped to Pfam PF01003 |
![]() | Family a.190.1.0: automated matches [348805] (1 protein) not a true family |
![]() | Protein automated matches [348806] (3 species) not a true protein |
![]() | Species Zika virus (strain mr 766) [TaxId:64320] [348807] (1 PDB entry) |
![]() | Domain d5yghb_: 5ygh B: [348808] automated match to d1r6ra_ |
PDB Entry: 5ygh (more details), 1.88 Å
SCOPe Domain Sequences for d5yghb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yghb_ a.190.1.0 (B:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]} pfgglkrlpaglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiikkfk kdlaamlriinar
Timeline for d5yghb_: