SCOPe 2.05: Domain d3dfra_: 3dfr A:

Lineage for d3dfra_ (3dfr A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Lactobacillus casei [TaxId:1582] [53601] (10 PDB entries)

8. Domain d3dfra_: 3dfr A: [34880]
   complexed with mtx, ndp

Details for d3dfra_

PDB Entry: 3dfr, 1.7 Å

PDB Description: crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3dfra_:

Sequence; same for both SEQRES and ATOM records:

>d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]}
taflwaqnrngligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhldqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

Timeline for d3dfra_:

• d3dfra_ first appeared (with stable ids) in SCOP 1.55, called d3dfr__
  
• d3dfra_ appears in SCOPe 2.04
  
• d3dfra_ appears in SCOPe 2.06
  
• d3dfra_ appears in the current release, SCOPe 2.08