SCOP 1.63: Domain d3dfr__: 3dfr -

Lineage for d3dfr__ (3dfr -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Lactobacillus casei [TaxId:1582] [53601] (6 PDB entries)

8. Domain d3dfr__: 3dfr - [34880]
   complexed with mtx, ndp

Details for d3dfr__

PDB Entry: 3dfr, 1.7 Å

PDB Description: crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate

SCOP Domain Sequences for d3dfr__:

Sequence; same for both SEQRES and ATOM records:

>d3dfr__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqnrngligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhldqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

Timeline for d3dfr__:

• d3dfr__ first appeared (with stable ids) in SCOP 1.55
  
• d3dfr__ appears in SCOP 1.61
  
• d3dfr__ appears in SCOP 1.65
  
• d3dfr__ appears in the current release, SCOPe 2.08, called d3dfra_