Lineage for d3dfr__ (3dfr -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126773Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 126774Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 126775Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 126779Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 126844Species Lactobacillus casei [TaxId:1582] [53601] (5 PDB entries)
  8. 126845Domain d3dfr__: 3dfr - [34880]

Details for d3dfr__

PDB Entry: 3dfr (more details), 1.7 Å

PDB Description: crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate

SCOP Domain Sequences for d3dfr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dfr__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqnrngligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhldqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

SCOP Domain Coordinates for d3dfr__:

Click to download the PDB-style file with coordinates for d3dfr__.
(The format of our PDB-style files is described here.)

Timeline for d3dfr__: