Lineage for d5x7yc_ (5x7y C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805580Species Canis lupus [TaxId:9615] [257248] (3 PDB entries)
  8. 2805584Domain d5x7yc_: 5x7y C: [348786]
    automated match to d1df3a_
    complexed with peg

Details for d5x7yc_

PDB Entry: 5x7y (more details), 2.35 Å

PDB Description: crystal structure of the dog lipocalin allergen can f 6
PDB Compounds: (C:) Lipocalin-Can f 6 allergen

SCOPe Domain Sequences for d5x7yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x7yc_ b.60.1.0 (C:) automated matches {Canis lupus [TaxId: 9615]}
ndvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnssliftmhtkvn
gkctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefqlmelyg
rkpdvspkvkekfvrycqgmeipkenildltqvdrclqar

SCOPe Domain Coordinates for d5x7yc_:

Click to download the PDB-style file with coordinates for d5x7yc_.
(The format of our PDB-style files is described here.)

Timeline for d5x7yc_: