| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein Glutamate receptor ligand binding core [53881] (5 species) |
| Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries) |
| Domain d5o9aa1: 5o9a A:3-263 [348783] Other proteins in same PDB: d5o9aa2, d5o9ab2, d5o9ac2, d5o9ad2 automated match to d4h8ja_ complexed with 7m6, cit, cl, edo, glu, gol, peg, so4 |
PDB Entry: 5o9a (more details), 1.78 Å
SCOPe Domain Sequences for d5o9aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o9aa1 c.94.1.1 (A:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecgs
Timeline for d5o9aa1: